PDB entry 2cpx

View 2cpx on RCSB PDB site
Description: solution structure of RNA binding domain in Hypothetical protein FLJ11016
Class: transcription
Keywords: RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein FLJ11016
  Species: Homo sapiens [TaxId:9606]
  Gene: FLJ11016
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96IZ5 (7-108)
    • cloning artifact (0-6)
    • cloning artifact (109-114)
  Domains in SCOPe 2.08: d2cpxa1, d2cpxa2, d2cpxa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cpxA (A:)
  gssgssgeeirkipmfssynpgepnkvlylknlsprvterdlvslfarfqekkgppiqfr
  mmtgrmrgqafitfpnkeiawqalhlvngyklygkilviefgknkkqrssgpssg