PDB entry 2cp9

View 2cp9 on RCSB PDB site
Description: Solution structure of RSGI RUH-042, a UBA domain from human mitochondrial elongation factor Ts
Class: protein binding
Keywords: UBA, structural genomics, human, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor Ts, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43897 (7-57)
      • cloning artifact (0-6)
      • cloning artifact (58-63)
    Domains in SCOPe 2.08: d2cp9a1, d2cp9a2, d2cp9a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cp9A (A:)
    gssgssgsskellmklrrktgysfvnckkaletcggdlkqaeiwlhkeaqkegwskaasg
    pssg