PDB entry 2coq

View 2coq on RCSB PDB site
Description: Structure of new antigen receptor variable domain from sharks
Class: immune system
Keywords: ig vnar, natural type2, 12a-9, immune system
Deposited on 2005-05-18, released 2005-10-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: new antigen receptor variable domain
    Species: Orectolobus maculatus [TaxId:168098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2coqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2coqA (A:)
    arvdqtpriatketgesltincvlrdtacaldstnwyrtklgstkeqtisiggrysetvd
    egsnsasltirdlrvedsgtykckayrrcafntgvgykegagtvltvk