PDB entry 2com

View 2com on RCSB PDB site
Description: The solution structure of the SWIRM domain of human LSD1
Class: oxidoreductase
Keywords: SWIRM domain, LSD1, AOF2, KIAA0601, histone modulation, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, OXIDOREDUCTASE
Deposited on 2005-05-18, released 2005-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lysine-specific histone demethylase 1
  Species: Homo sapiens [TaxId:9606]
  Gene: LSD1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60341 (7-117)
    • cloning artifact (0-6)
    • cloning artifact (118-123)
  Domains in SCOPe 2.08: d2coma1, d2coma2, d2coma3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2comA (A:)
  gssgssgeepsgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlw
  ldnpkiqltfeatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgsg
  pssg