PDB entry 2co1

View 2co1 on RCSB PDB site
Description: salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (f17a mutant)
Class: fibril protein
Keywords: pilus subunit, fibril protein, fold complementation
Deposited on 2006-05-25, released 2006-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.215
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: putative outer membrane protein
  Species: Salmonella typhimurium [TaxId:602]
  Database cross-references and differences (RAF-indexed):
  • PDB 2CO1
  • Uniprot Q8ZRK4 (2-124)
  Domains in SCOPe 2.08: d2co1a_
• Chain 'B':
  Compound: putative outer membrane protein
  Species: SALMONELLA TYPHIMURIUM, synthetic [TaxId:602]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8ZRK4 (0-19)
    • engineered mutation (16)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2co1A (A:)
  gsdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagk
  ntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldv
  vgyqp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2co1A (A:)
  dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt
  gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg
  yqp
  

  
  
• Chain 'B':
  No sequence available.