PDB entry 2cnh

View 2cnh on RCSB PDB site
Description: Structural Insights into the Design of Nonpeptidic Isothiazolidinone- Containing Inhibitors of Protein Tyrosine Phosphatase 1B
Class: hydrolase
Keywords: polymorphism, phosphorylation, protein phosphatase, endoplasmic reticulum, oxidation, hydrolase, acetylation, phosphatase
Deposited on 2006-05-21, released 2006-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cnha_
  • Heterogens: CA, IZB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cnhA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle
    pppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cnhA (A:)
    mekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqe
    dndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkca
    qywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdf
    gvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdps
    svdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedl