PDB entry 2cna

View 2cna on RCSB PDB site
Description: the covalent and three-dimensional structure of concanavalin a, iv.atomic coordinates,hydrogen bonding,and quaternary structure
Deposited on 1975-04-01, released 1977-03-16
The last revision prior to the SCOP 1.61 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d2cna__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cna_ (-)
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqdgkvgtahiiynsvdkr
lsavvsypnadatsvsydvdlndvlpewvrvglsastglyketntilswsftsklksnst
hqtdalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspegssvgralfyapvh
iwessatvsafeatfaflikspdshpadgiaffisnidssipsgstgrllglfpdan