PDB entry 2cls

View 2cls on RCSB PDB site
Description: the crystal structure of the human rnd1 gtpase in the active GTP bound state
Class: nucleotide binding protein
Keywords: nucleotide-binding, GTP-binding protein rho6, membrane, prenylation, lipoprotein, GTP-binding, cytoskeleton, small gtpase, nucleotide binding protein
Deposited on 2006-04-28, released 2006-05-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.207
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rho-related GTP-binding protein rho6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2clsa_
  • Chain 'B':
    Compound: rho-related GTP-binding protein rho6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2clsb_
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2clsA (A:)
    smrapqpvvarcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacleteeqrve
    lslwdtsgspyydnvrplcysdsdavllcfdisrpetvdsalkkwrteildycpstrvll
    igcktdlrtdlstlmelshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrt
    asmlclnkpsplpqkspv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2clsA (A:)
    vvarcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacleteeqrvelslwdts
    gspyydnvrplcysdsdavllcfdisrpetvdsalkkwrteildycpstrvlligcktdl
    rtdlstlmelshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrtasmlcl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2clsB (B:)
    smrapqpvvarcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacleteeqrve
    lslwdtsgspyydnvrplcysdsdavllcfdisrpetvdsalkkwrteildycpstrvll
    igcktdlrtdlstlmelshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrt
    asmlclnkpsplpqkspv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2clsB (B:)
    varcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacleteeqrvelslwdtsg
    spyydnvrplcysdsdavllcfdisrpetvdsalkkwrteildycpstrvlligcktdlr
    tdlstlmelshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrtasmlcl