PDB entry 2cld

View 2cld on RCSB PDB site
Description: crystal structure analysis of a fluorescent form of h-ras p21 in complex with GDP (2)
Class: nucleotide-binding protein
Keywords: nucleotide-binding protein, guanine nucleotide binding protein, palmitate, caged GTP, prenylation, fluorescence
Deposited on 2006-04-27, released 2006-05-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: 0.15
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (117)
    Domains in SCOPe 2.04: d2cldx_
  • Heterogens: MG, GDP

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download) 
    >2cldX (X:)
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

    Sequence, based on observed residues (ATOM records): (download) 
    >2cldX (X:)
mteyklvvvgaggvgksaltiqliqnhfvdptiedsyrkqvvidgetclldildtagqee
ysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdlaar
tvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh