PDB entry 2cl8

View 2cl8 on RCSB PDB site
Description: dectin-1 in complex with beta-glucan
Class: receptor
Keywords: carbohydrate, fungal recognition, ctld, receptor, dectin-1, laminarin, beta-glucan, c-type lectin-like domain
Deposited on 2006-04-26, released 2007-05-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.194
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dectin-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6QLQ4 (Start-131)
    • PDB 2CL8 (132-End)
    Domains in SCOPe 2.03: d2cl8a_
  • Chain 'B':
    Compound: dectin-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6QLQ4 (Start-131)
    • PDB 2CL8 (132-End)
    Domains in SCOPe 2.03: d2cl8b_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cl8A (A:)
    ggfsqsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtss
    hrinafwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqic
    ntssysicekelkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cl8A (A:)
    qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
    afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
    ysicekelk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cl8B (B:)
    ggfsqsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtss
    hrinafwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqic
    ntssysicekelkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cl8B (B:)
    qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
    afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
    ysicekelk