PDB entry 2cl1

View 2cl1 on RCSB PDB site
Description: human nek2 kinase with pyrrole-indolinone ligand
Class: transferase
Keywords: phosphorylation, nucleotide-binding, ATP-binding, transferase, coiled coil, polymorphism, cell division, metal-binding, nuclear protein, alternative splicing, serine/threonine-protein kinase, kinase, meiosis, mitosis, magnesium, cell cycle
Deposited on 2006-04-25, released 2006-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2006-12-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase nek2
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cl1a_
  • Heterogens: 5Z5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cl1A (A:)
    mpsraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllr
    elkhpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtql
    tlalkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfakafvgtp
    yymspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyry
    sdelneiitrmlnlkdyhrpsveeilenplilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cl1A (A:)
    sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmtmlvsevnllrelkhpni
    vryydriidtlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalkechrrs
    hrdlkpanvfldgkqnvklgdfglarilgtpyymspeqmnrmsyneksdiwslgcllyel
    calmppftafsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrpsveeilenp
    lilehhhhhh