PDB entry 2cl0

View 2cl0 on RCSB PDB site
Description: crystal structure analysis of a fluorescent form of h-ras p21 in complex with gppnhp
Class: nucleotide binding protein
Keywords: nucleotide binding protein, methylation, lipoprotein, GTP-binding, fluorescence, gppnhp, membrane, palmitate, prenylation, proto-oncogene, golgi apparatus, disease mutation, nucleotide-binding, guanine nucleotide binding protein
Deposited on 2006-04-25, released 2006-05-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.148
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (31)
      • engineered mutation (117)
    Domains in SCOPe 2.05: d2cl0x_
  • Heterogens: MG, TRS, GNP, XY2, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cl0X (X:)
    mteyklvvvgaggvgksaltiqliqnhfvdecdptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh