PDB entry 2ckw

View 2ckw on RCSB PDB site
Description: the 2.3 a resolution structure of the sapporo virus RNA dependant RNA polymerase.
Class: hydrolase
Keywords: hydrolase, nucleotide-binding, nucleotidyltransferase, covalent protein-RNA linkage, polymerase, RNA elongation, transferase activity, mutant, capsid protein, RNA replication, structural protein, protease, helicase, transferase, RNA-directed RNA polymerase, polyprotein, ATP-binding, thiol protease
Deposited on 2006-04-24, released 2006-11-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-directed RNA polymerase
    Species: SAPPORO VIRUS [TaxId:95342]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ckwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ckwA (A:)
    defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
    lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
    fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
    rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
    ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
    gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygddcmysvcpatasi
    fhtvlanltsyglkptaadksdaikptntpvflkrtftqtphgirallditsitrqfywl
    kanrtsdpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntn
    ydqalatynawfiggtvpdpvghtegthkivfeme
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ckwA (A:)
    defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
    lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
    fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
    rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
    ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
    gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygddcmysvcpatasi
    fhtvlanltsyglkpkptntpvflkrtftqtphgirallditsitrqfywlkanrtsdps
    sppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntnydqalatyn
    awfiggt