PDB entry 2ckf

View 2ckf on RCSB PDB site
Description: crystal structure of the terminal component of the pah-hydroxylating dioxygenase from sphingomonas sp chy-1
Class: oxidoreductase
Keywords: rieske non heme iron dioxygenase, pyrene dioxygenase, ring-hydroxylating dioxygenase, high-molecular-weight polycyclic aromatic hydrocarbons, oxidoreductase
Deposited on 2006-04-18, released 2007-01-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ring-hydroxylating dioxygenase alpha subunit
    Species: SPHINGOMONAS SP. [TaxId:279135]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ckfa1, d2ckfa2
  • Chain 'B':
    Compound: ring-hydroxylating dioxygenase beta subunit
    Species: SPHINGOMONAS SP. [TaxId:279135]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ckfb_
  • Chain 'C':
    Compound: ring-hydroxylating dioxygenase alpha subunit
    Species: SPHINGOMONAS SP. [TaxId:279135]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ckfc1, d2ckfc2
  • Chain 'D':
    Compound: ring-hydroxylating dioxygenase beta subunit
    Species: SPHINGOMONAS SP. [TaxId:279135]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ckfd_
  • Chain 'E':
    Compound: ring-hydroxylating dioxygenase alpha subunit
    Species: SPHINGOMONAS SP. [TaxId:279135]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ckfe1, d2ckfe2
  • Chain 'F':
    Compound: ring-hydroxylating dioxygenase beta subunit
    Species: SPHINGOMONAS SP. [TaxId:279135]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ckff_
  • Heterogens: FES, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ckfA (A:)
    msgdttlvdtvnasqsrqvfwdrdvydleierifsrawlmlghksllpkpgdfittymae
    dkiilshqsdgtfrafinscthrgnqichadsgnakafvcnyhgwvygqdgslvdvples
    rcyhnkldkqelaaksvrvetykgfifgchdpeapsledylgefrfyldtiwegggagle
    llgppmksllhcnwkvpvenfvgdgyhvgwthaaalgqiggplaglagnradipfddlgl
    qfttrhghgfgvidnaaaaihrkgdgwnkyledtrgevrrkfgadrerlyvghwngaifp
    ncsflygtntfkiwhprgpheievwtytmvpsdadpatksaiqreatrtfgtagtlesdd
    genmssatyvnrgvitrdgmmnstmgvgyegphpvypgivgisfigetsyrgfyrfwkem
    idapdwasvkanddnwdsvftnrnfwneklnaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ckfA (A:)
    msgdttlvdtvnasqsrqvfwdrdvydleierifsrawlmlghksllpkpgdfittymae
    dkiilshqsdgtfrafinscthrgnqichadsgnakafvcnyhgwvygqdgslvdvples
    rcyhnkldkqelaaksvrvetykgfifgchdpeapsledylgefrfyldtiwegggagle
    llgppmksllhcnwkvpvenfvgdgyhvgwthaaalgqiggplaglagnraddlglqftt
    rhghgfgvidnaaaaihrkgdgwnkyledtrgevrrkfgadrerlyvghwngaifpncsf
    lygtntfkiwhprgpheievwtytmvpsdadpatksaiqreatrtfgtagtlesddgenm
    ssatyvnrgvitrdgmmnstmgvgyegphpvypgivgisfigetsyrgfyrfwkemidap
    dwasvkanddnwdsvftnrnfwneklna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ckfB (B:)
    msteqvpvtpdvhyaveahyraevrllqtgqyrewlhgmvaedihywmpiyeqrfvrdrr
    pdptpddaaiynddfeelkqrverlysgqvwmedppskiryfvsnveafeaengeldvls
    nilvyrnrrqtevtvhtlgredklrqdgngfkvfrrklildarvtqdknlyffc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ckfB (B:)
    qvpvtpdvhyaveahyraevrllqtgqyrewlhgmvaedihywmpiyeqrfvrdrrpdpt
    pddaaiynddfeelkqrverlysgqvwmedppskiryfvsnveafeaengeldvlsnilv
    yrnrrqtevtvhtlgredklrqdgngfkvfrrklildarvtqdknlyffc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ckfC (C:)
    msgdttlvdtvnasqsrqvfwdrdvydleierifsrawlmlghksllpkpgdfittymae
    dkiilshqsdgtfrafinscthrgnqichadsgnakafvcnyhgwvygqdgslvdvples
    rcyhnkldkqelaaksvrvetykgfifgchdpeapsledylgefrfyldtiwegggagle
    llgppmksllhcnwkvpvenfvgdgyhvgwthaaalgqiggplaglagnradipfddlgl
    qfttrhghgfgvidnaaaaihrkgdgwnkyledtrgevrrkfgadrerlyvghwngaifp
    ncsflygtntfkiwhprgpheievwtytmvpsdadpatksaiqreatrtfgtagtlesdd
    genmssatyvnrgvitrdgmmnstmgvgyegphpvypgivgisfigetsyrgfyrfwkem
    idapdwasvkanddnwdsvftnrnfwneklnaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ckfC (C:)
    msgdttlvdtvnasqsrqvfwdrdvydleierifsrawlmlghksllpkpgdfittymae
    dkiilshqsdgtfrafinscthrgnqichadsgnakafvcnyhgwvygqdgslvdvples
    rcyhnkldkqelaaksvrvetykgfifgchdpeapsledylgefrfyldtiwegggagle
    llgppmksllhcnwkvpvenfvgdgyhvgwthaaallglqfttrhghgfgvidnaaaaih
    rkgdgwnkyledtrgevrrkfgadrerlyvghwngaifpncsflygtntfkiwhprgphe
    ievwtytmvpsdadpatksaiqreatrtfgtagtlesddgenmssatyvnrgvitrdgmm
    nstmgvgyegphpvypgivgisfigetsyrgfyrfwkemidapdwasvkanddnwdsvft
    nrnfw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ckfD (D:)
    msteqvpvtpdvhyaveahyraevrllqtgqyrewlhgmvaedihywmpiyeqrfvrdrr
    pdptpddaaiynddfeelkqrverlysgqvwmedppskiryfvsnveafeaengeldvls
    nilvyrnrrqtevtvhtlgredklrqdgngfkvfrrklildarvtqdknlyffc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ckfD (D:)
    qvpvtpdvhyaveahyraevrllqtgqyrewlhgmvaedihywmpiyeqrfvrdrrpdpt
    pddaaiynddfeelkqrverlysgqvwmedppskiryfvsnveafeaengeldvlsnilv
    yrnrrqtevtvhtlgredklrqdgngfkvfrrklildarvtqdknlyffc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ckfE (E:)
    msgdttlvdtvnasqsrqvfwdrdvydleierifsrawlmlghksllpkpgdfittymae
    dkiilshqsdgtfrafinscthrgnqichadsgnakafvcnyhgwvygqdgslvdvples
    rcyhnkldkqelaaksvrvetykgfifgchdpeapsledylgefrfyldtiwegggagle
    llgppmksllhcnwkvpvenfvgdgyhvgwthaaalgqiggplaglagnradipfddlgl
    qfttrhghgfgvidnaaaaihrkgdgwnkyledtrgevrrkfgadrerlyvghwngaifp
    ncsflygtntfkiwhprgpheievwtytmvpsdadpatksaiqreatrtfgtagtlesdd
    genmssatyvnrgvitrdgmmnstmgvgyegphpvypgivgisfigetsyrgfyrfwkem
    idapdwasvkanddnwdsvftnrnfwneklnaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ckfE (E:)
    msgdttlvdtvnasqsrqvfwdrdvydleierifsrawlmlghksllpkpgdfittymae
    dkiilshqsdgtfrafinscthrgnqichadsgnakafvcnyhgwvygqdgslvdvples
    rcyhnkldkqelaaksvrvetykgfifgchdpeapsledylgefrfyldtiwegggagle
    llgppmksllhcnwkvpvenfvgdgyhvgwthaaalgqglqfttrhghgfgvidnaaaai
    hrkgdgwnkyledtrgevrrkfgadrerlyvghwngaifpncsflygtntfkiwhprgph
    eievwtytmvpsdadpatksaiqreatrtfgtagtlesddgenmssatyvnrgvitrdgm
    mnstmgvgyegphpvypgivgisfigetsyrgfyrfwkemidapdwasvkanddnwdsvf
    tnrnfwneklnaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ckfF (F:)
    msteqvpvtpdvhyaveahyraevrllqtgqyrewlhgmvaedihywmpiyeqrfvrdrr
    pdptpddaaiynddfeelkqrverlysgqvwmedppskiryfvsnveafeaengeldvls
    nilvyrnrrqtevtvhtlgredklrqdgngfkvfrrklildarvtqdknlyffc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ckfF (F:)
    qvpvtpdvhyaveahyraevrllqtgqyrewlhgmvaedihywmpiyeqrfvrdrrpdpt
    pddaaiynddfeelkqrverlysgqvwmedppskiryfvsnveafeaengeldvlsnilv
    yrnrrqtevtvhtlgredklrqdgngfkvfrrklildarvtqdknlyffc