PDB entry 2cjw

View 2cjw on RCSB PDB site
Description: crystal structure of the small gtpase gem (gemdndcam) in complex to mg.GDP
Class: g-protein
Keywords: g-protein, nucleotide-binding, GTP-binding, small gtpase, conformational change, cysteine-modified, g-protein hydrolase
Deposited on 2006-04-09, released 2006-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein gem
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CJW (Start-3)
    • Uniprot P55040 (4-End)
    Domains in SCOPe 2.06: d2cjwa_
  • Chain 'B':
    Compound: GTP-binding protein gem
    Species: Homo sapiens [TaxId:9606]
    Domains in SCOPe 2.06: d2cjwb_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cjwA (A:)
    efgmtyyrvvligeqgvgkstlanifagvhdsmdsdcevlgedtyertlmvdgesatiil
    ldmwenkgenewlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilv
    gnksdlvrcrevsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrrdskekn
    errlayqkrkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjwA (A:)
    mtyyrvvligeqgvgkstlanifagvhdscevlgedtyertlmvdgesatiilldmwene
    wlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilvgnksdlvrcre
    vsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrrdskeknerrlayqkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cjwB (B:)
    efgmtyyrvvligeqgvgkstlanifagvhdsmdsdcevlgedtyertlmvdgesatiil
    ldmwenkgenewlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilv
    gnksdlvrcrevsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrrdskekn
    errlayqkrkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjwB (B:)
    efgmtyyrvvligeqgvgkstlanifagvedtyertlmvdgesatiilldmwenhdhcmq
    vgdaylivysitdrasfekaselriqlrrarqtedipiilvgnksdlvrcrevsvsegra
    cavvfdckfietsaavqhnvkelfegivrqvrlrrdskeknerrlayqkrkes