PDB entry 2cjv

View 2cjv on RCSB PDB site
Description: crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq10-1.12 scfv in complex with phoxgaba
Class: immune systyem
Keywords: scfv, antibody, immunoglobulin, 2-phenyl-5-oxazolone, immunoglobulin domain, immune systyem
Deposited on 2006-04-09, released 2006-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2006-06-28, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.25
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: nq10-1.12 anti-phox antibody
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • PDB 2CJV (0-17)
    Domains in SCOPe 2.06: d2cjvh_
  • Chain 'J':
    Compound: nq10-1.12 anti-phox antibody
    Species: Mus musculus
    Domains in SCOPe 2.06: d2cjvj_
  • Chain 'K':
    Compound: nq10-1.12 anti-phox antibody
    Species: Mus musculus
    Domains in SCOPe 2.06: d2cjvk_
  • Chain 'L':
    Compound: nq10-1.12 anti-phox antibody
    Species: Mus musculus
    Domains in SCOPe 2.06: d2cjvl_
  • Chain 'S':
    Compound: nq10-1.12 anti-phox antibody
    Species: Mus musculus
  • Chain 'T':
    Compound: nq10-1.12 anti-phox antibody
    Species: Mus musculus
  • Heterogens: PHX, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cjvH (H:)
    evklvesggglvqpggslrlscatsgfsftdyymawvrqppgkalewlafirnkangytt
    dysasvkgrftisrdnsqsilylqmntlraedsatyycargdyygawfaywgqgtlvtvs
    a
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cjvJ (J:)
    evklvesggglvqpggslrlscatsgfsftdyymawvrqppgkalewlafirnkangytt
    dysasvkgrftisrdnsqsilylqmntlraedsatyycargsyygawfaywgqgtlvtvs
    a
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cjvK (K:)
    qvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cjvL (L:)
    qvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.