PDB entry 2cij

View 2cij on RCSB PDB site
Description: membrane-bound glutamate carboxypeptidase II (GCPII) with bound methionine
Class: hydrolase
Keywords: neurodegenerative disease, peptidase, prostate cancer, psma, glycoprotein, hydrolase, antigen, metal-binding, metalloprotease, multifunctional enzyme, signal-anchor, transmembrane
Deposited on 2006-03-21, released 2007-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.174
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cija1, d2cija2, d2cija3
  • Heterogens: MET, ZN, CA, CL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cijA (A:)
    kssneatnitpkhnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkef
    gldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsa
    fspqgmpegdlvyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagak
    gvilysdpadyfapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgi
    aeavglpsipvhpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvk
    mhihstnevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfg
    tlkkegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlr
    vdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfev
    ffqrlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggm
    vfelansivlpfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteia
    skfserlqdfdksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyage
    sfpgiydalfdieskvdpskawgevkrqiyvaaftvqaaaetlseva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cijA (A:)
    nmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydvl
    lsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvy
    vnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfa
    pgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhp
    igyydaqkllekmggsappdsswrgslkvpynvgpgftfstqkvkmhihstnevtriynv
    igtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprrtilf
    aswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslvhnlt
    kelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgraryt
    knfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpfdcrdyavv
    lrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfdksnpivlrm
    mndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdieskvdpsk
    awgevkrqiyvaaftvqaaaetlseva