PDB entry 2cih

View 2cih on RCSB PDB site
Description: recombinant human h ferritin, k86q and e27d mutant, soaked with zn
Class: oxidoreductase
Keywords: apoferritin, ferroxidase, di-iron non-heme protein, iron storage, iron, metal-binding, oxidoreductase, phosphorylation
Deposited on 2006-03-21, released 2006-12-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.169
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CIH
      • engineered mutation (27)
      • engineered mutation (86)
    • Uniprot P02794
    Domains in SCOPe 2.03: d2ciha_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cihA (A:)
    mttastsqvrqnyhqdseaainrqinldlyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsd
    nes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cihA (A:)
    tsqvrqnyhqdseaainrqinldlyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
    ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg