PDB entry 2cig

View 2cig on RCSB PDB site
Description: Dihydrofolate reductase from Mycobacterium tuberculosis inhibited by the acyclic 4R isomer of INH-NADP a derivative of the prodrug isoniazid.
Class: oxidoreductase
Keywords: nadp, isoniazid, reductase, inhibitor, bisubstrate, tuberculosis, oxidoreductase, one-carbon metabolism
Deposited on 2006-03-20, released 2006-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Mycobacterium tuberculosis [TaxId:83332]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A546 (0-158)
    • conflict (45)
  Domains in SCOPe 2.08: d2ciga_
• Heterogens: 1DG, GOL, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cigA (A:)
  mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrvwdslpakvrplpgr
  rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
  reagdalapvldetwrgetgewrfsrsglryrlysyhrs