PDB entry 2chm

View 2chm on RCSB PDB site
Description: crystal structure of n2 substituted pyrazolo pyrimidinones-a flipped binding mode in pde5
Class: hydrolase
Keywords: phosphodiesterase 5, inhibitor, chimera, allosteric enzyme, alternative splicing, cgmp, cgmp-binding, hydrolase, magnesium, metal-binding, nucleotide-binding, phosphorylation, zinc, camp
Deposited on 2006-03-15, released 2006-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.1947
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cgmp-specific 3', 5'-cyclic phosphodiesterase, camp-specific 3', 5'-cyclic phosphodiesterase 4b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76074 (149-325)
      • conflict (218)
    • Uniprot Q07343 (123-147)
    Domains in SCOPe 2.07: d2chma1
  • Heterogens: ZN, MG, 3P4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2chmA (A:)
    eeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhe
    vlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalsh
    dldhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeyktt
    lkiikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpw
    piqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyeal
    thvsedcfplldgcrknrqkwqalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chmA (A:)
    trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
    rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
    hpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlki
    ikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpiq
    qriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthv
    sedcfplldgcrknrqkwqalae