PDB entry 2ch1

View 2ch1 on RCSB PDB site
Description: structure of anopheles gambiae 3-hydroxykynurenine transaminase
Class: transferase
Keywords: plp-enzyme, kynurenine pathway, anopheles gambiae, 3-hydroxykynurenine transaminase, transferase
Deposited on 2006-03-10, released 2006-03-28
The last revision prior to the SCOP 1.75 freeze date was dated 2006-04-19, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxykynurenine transaminase
    Species: Anopheles gambiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ch1a1
  • Chain 'B':
    Compound: 3-hydroxykynurenine transaminase
    Species: Anopheles gambiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ch1b1
  • Chain 'C':
    Compound: 3-hydroxykynurenine transaminase
    Species: Anopheles gambiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ch1c1
  • Chain 'D':
    Compound: 3-hydroxykynurenine transaminase
    Species: Anopheles gambiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ch1d1
  • Heterogens: LLP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ch1A (A:)
    mkftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdgl
    ryifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvr
    tiegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivda
    vaslcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdl
    lllgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgk
    mgldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgim
    gecstvqkiqfylygfkeslkathpdyifeesngfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ch1A (A:)
    kftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglr
    yifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrt
    iegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdav
    aslcgvpfymdkweidavytgaqvlgappgitpisispkaldvirnrrtkskvfywdlll
    lgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkmg
    ldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimge
    cstvqkiqfylygfkeslkathpdyif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ch1B (B:)
    mkftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdgl
    ryifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvr
    tiegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivda
    vaslcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdl
    lllgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgk
    mgldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgim
    gecstvqkiqfylygfkeslkathpdyifeesngfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ch1B (B:)
    kftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglr
    yifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrt
    iegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdav
    aslcgvpfymdkweidavytgaqvlgappgitpisispkaldvirnrrtkskvfywdlll
    lgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkmg
    ldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimge
    cstvqkiqfylygfkeslkathpdyif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ch1C (C:)
    mkftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdgl
    ryifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvr
    tiegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivda
    vaslcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdl
    lllgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgk
    mgldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgim
    gecstvqkiqfylygfkeslkathpdyifeesngfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ch1C (C:)
    kftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglr
    yifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrt
    iegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdav
    aslcgvpfymdkweidavytgaqvlgappgitpisispkaldvirnrrtkskvfywdlll
    lgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkmg
    ldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimge
    cstvqkiqfylygfkeslkathpdyif
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ch1D (D:)
    mkftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdgl
    ryifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvr
    tiegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivda
    vaslcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdl
    lllgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgk
    mgldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgim
    gecstvqkiqfylygfkeslkathpdyifeesngfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ch1D (D:)
    kftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglr
    yifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrt
    iegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdav
    aslcgvpfymdkweidavytgaqvlgappgitpisispkaldvirnrrtkskvfywdlll
    lgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkmg
    ldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimge
    cstvqkiqfylygfkeslkathpdyif