PDB entry 2cgt

View 2cgt on RCSB PDB site
Description: GROEL-ADP-gp31 COMPLEX
Class: chaperone
Keywords: chaperonin, chaperone, cell cycle, cell division, capsid assembly, early protein
Deposited on 2006-03-09, released 2006-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: EM
Resolution: 8.2 Å
R-factor: N/A
AEROSPACI score: -0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 60 kda groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: capsid assembly protein gp31
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cgto1
  • Chain 'P':
    Compound: capsid assembly protein gp31
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cgtp1
  • Chain 'Q':
    Compound: capsid assembly protein gp31
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cgtq1
  • Chain 'R':
    Compound: capsid assembly protein gp31
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cgtr1
  • Chain 'S':
    Compound: capsid assembly protein gp31
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cgts1
  • Chain 'T':
    Compound: capsid assembly protein gp31
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cgtt1
  • Chain 'U':
    Compound: capsid assembly protein gp31
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cgtu1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2cgtO (O:)
    msevqqlpiravgeyvilvsepaqagdeevtesgliigkrvqgevpelcvvhsvgpdvpe
    gfcevgdltslpvgqirnvphpfvalglkqpkeikqkfvtchykaipclyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cgtO (O:)
    qqlpiravgeyvilvsepelcvvhsvgpdvpegfcevgdltslpvgqirnvphpfvalgl
    kqpkeikqkfvtchykaipclyk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2cgtP (P:)
    msevqqlpiravgeyvilvsepaqagdeevtesgliigkrvqgevpelcvvhsvgpdvpe
    gfcevgdltslpvgqirnvphpfvalglkqpkeikqkfvtchykaipclyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cgtP (P:)
    qqlpiravgeyvilvsepelcvvhsvgpdvpegfcevgdltslpvgqirnvphpfvalgl
    kqpkeikqkfvtchykaipclyk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2cgtQ (Q:)
    msevqqlpiravgeyvilvsepaqagdeevtesgliigkrvqgevpelcvvhsvgpdvpe
    gfcevgdltslpvgqirnvphpfvalglkqpkeikqkfvtchykaipclyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cgtQ (Q:)
    qqlpiravgeyvilvsepelcvvhsvgpdvpegfcevgdltslpvgqirnvphpfvalgl
    kqpkeikqkfvtchykaipclyk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2cgtR (R:)
    msevqqlpiravgeyvilvsepaqagdeevtesgliigkrvqgevpelcvvhsvgpdvpe
    gfcevgdltslpvgqirnvphpfvalglkqpkeikqkfvtchykaipclyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cgtR (R:)
    qqlpiravgeyvilvsepelcvvhsvgpdvpegfcevgdltslpvgqirnvphpfvalgl
    kqpkeikqkfvtchykaipclyk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2cgtS (S:)
    msevqqlpiravgeyvilvsepaqagdeevtesgliigkrvqgevpelcvvhsvgpdvpe
    gfcevgdltslpvgqirnvphpfvalglkqpkeikqkfvtchykaipclyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cgtS (S:)
    qqlpiravgeyvilvsepelcvvhsvgpdvpegfcevgdltslpvgqirnvphpfvalgl
    kqpkeikqkfvtchykaipclyk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2cgtT (T:)
    msevqqlpiravgeyvilvsepaqagdeevtesgliigkrvqgevpelcvvhsvgpdvpe
    gfcevgdltslpvgqirnvphpfvalglkqpkeikqkfvtchykaipclyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cgtT (T:)
    qqlpiravgeyvilvsepelcvvhsvgpdvpegfcevgdltslpvgqirnvphpfvalgl
    kqpkeikqkfvtchykaipclyk
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2cgtU (U:)
    msevqqlpiravgeyvilvsepaqagdeevtesgliigkrvqgevpelcvvhsvgpdvpe
    gfcevgdltslpvgqirnvphpfvalglkqpkeikqkfvtchykaipclyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cgtU (U:)
    qqlpiravgeyvilvsepelcvvhsvgpdvpegfcevgdltslpvgqirnvphpfvalgl
    kqpkeikqkfvtchykaipclyk