PDB entry 2cgn

View 2cgn on RCSB PDB site
Description: factor inhibiting hif-1 alpha with succinate
Class: oxidoreductase
Keywords: 2-oxoglutarate, acetylation, activator, oxidoreductase, alternative splicing, asparaginyl hydroxylase, DNA-binding, dsbh, fi, hif, hydroxylation, hypoxia, nuclear protein, oxygenase, phosphorylation, polymorphism, s-nitrosylation, transcription, transcription activator/inhibitor, transcription regulation
Deposited on 2006-03-09, released 2006-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxia-inducible factor 1 alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cgna_
  • Heterogens: FE, SIN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cgnA (A:)
    maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
    pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
    eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
    qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
    qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
    ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cgnA (A:)
    ataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepv
    vltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfnreemkfhefv
    eklqdiqqreerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligm
    egnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyer
    fpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplk
    ahqkvaimrniekmlgealgnpqevgpllntmikgryn