PDB entry 2cf7

View 2cf7 on RCSB PDB site
Description: asp74ala mutant crystal structure for dps-like peroxide resistance protein dpr from streptococcus suis.
Class: peroxide resistance
Keywords: peroxide resistance, dps-family, ferritin-like, ferroxidase, iron-binding
Deposited on 2006-02-16, released 2006-09-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.154
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dpr
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (Start-164)
      • engineered mutation (66)
    Domains in SCOPe 2.04: d2cf7a_
  • Chain 'B':
    Compound: dpr
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (Start-164)
      • engineered mutation (66)
    Domains in SCOPe 2.04: d2cf7b_
  • Chain 'C':
    Compound: dpr
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (Start-164)
      • engineered mutation (66)
    Domains in SCOPe 2.04: d2cf7c_
  • Chain 'D':
    Compound: dpr
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (Start-164)
      • engineered mutation (66)
    Domains in SCOPe 2.04: d2cf7d_
  • Chain 'E':
    Compound: dpr
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (Start-164)
      • engineered mutation (66)
    Domains in SCOPe 2.04: d2cf7e_
  • Chain 'F':
    Compound: dpr
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (Start-164)
      • engineered mutation (66)
    Domains in SCOPe 2.04: d2cf7f_
  • Chain 'G':
    Compound: dpr
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (Start-164)
      • engineered mutation (66)
    Domains in SCOPe 2.04: d2cf7g_
  • Chain 'H':
    Compound: dpr
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (Start-164)
      • engineered mutation (66)
    Domains in SCOPe 2.04: d2cf7h_
  • Chain 'I':
    Compound: dpr
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (Start-164)
      • engineered mutation (66)
    Domains in SCOPe 2.04: d2cf7i_
  • Chain 'J':
    Compound: dpr
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (Start-164)
      • engineered mutation (66)
    Domains in SCOPe 2.04: d2cf7j_
  • Chain 'K':
    Compound: dpr
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (Start-164)
      • engineered mutation (66)
    Domains in SCOPe 2.04: d2cf7k_
  • Chain 'L':
    Compound: dpr
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (Start-164)
      • engineered mutation (66)
    Domains in SCOPe 2.04: d2cf7l_
  • Heterogens: EPE, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cf7A (A:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgylaemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cf7A (A:)
    asfsprpdskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaem
    serlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvs
    deegdsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cf7B (B:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgylaemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cf7B (B:)
    adskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserlit
    lggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegds
    vtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cf7C (C:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgylaemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cf7C (C:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cf7D (D:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgylaemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cf7D (D:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2cf7E (E:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgylaemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cf7E (E:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2cf7F (F:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgylaemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cf7F (F:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2cf7G (G:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgylaemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cf7G (G:)
    psladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemser
    litlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdee
    gdsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2cf7H (H:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgylaemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cf7H (H:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2cf7I (I:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgylaemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cf7I (I:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2cf7J (J:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgylaemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cf7J (J:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2cf7K (K:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgylaemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cf7K (K:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2cf7L (L:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgylaemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cf7L (L:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl