PDB entry 2cei

View 2cei on RCSB PDB site
Description: recombinant human h ferritin, k86q mutant, soaked with zn
Class: oxidoreductase
Keywords: apoferritin,ferroxidase,di-iron,non-heme protein,iron storage,oxidoreductase
Deposited on 2006-02-07, released 2006-12-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2CEI
      • engineered mutation (86)
    • Uniprot P02794
    Domains in SCOP 1.73: d2ceia1
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ceiA (A:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsd
    nes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ceiA (A:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
    ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg