PDB entry 2ce4

View 2ce4 on RCSB PDB site
Description: manganese superoxide dismutase (mn-sod) from deinococcus radiodurans
Class: oxidoreductase
Keywords: manganese superoxide dismutase, deinococcus radiodurans, radiation resistance, oxidoreductase
Deposited on 2006-02-03, released 2006-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE4
    • Uniprot Q9RUV2 (21-230)
    Domains in SCOPe 2.07: d2ce4a1, d2ce4a2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CE4 (Start-20)
    • Uniprot Q9RUV2 (21-230)
    Domains in SCOPe 2.07: d2ce4b1, d2ce4b2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ce4A (A:)
    msyyhhhhhhlestslykkalaytlpqlpyaydalephidartmeihhtkhhqtyvdnan
    kalegtefadlpveqliqqldrvpadkkgalrnnagghanhsmfwqimgqgqgqnganqp
    sgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgea
    iagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce4A (A:)
    aytlpqlpyaydalephidartmeihhtkhhqtyvdnankaletefadlpveqliqqldr
    vpadkkgalrnnagghanhsmfwqimgqanqpsgelldainsafgsfdafkqkfedaakt
    rfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayylnyqnrrp
    dylaafwnvvnwdevskryaaak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ce4B (B:)
    msyyhhhhhhlestslykkalaytlpqlpyaydalephidartmeihhtkhhqtyvdnan
    kalegtefadlpveqliqqldrvpadkkgalrnnagghanhsmfwqimgqgqgqnganqp
    sgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgea
    iagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ce4B (B:)
    laytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqql
    drvpadkkgalrnnagghanhsmfwqimgqganqpsgelldainsafgsfdafkqkfeda
    aktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayylnyqn
    rrpdylaafwnvvnwdevskryaaak