PDB entry 2ce2

View 2ce2 on RCSB PDB site
Description: crystal structure analysis of a fluorescent form of h-ras p21 in complex with GDP
Class: signaling protein
Keywords: signaling protein, guanine nucleotide binding protein, fluorescence, membrane, lipoprotein, palmitate, prenylation
Deposited on 2006-02-02, released 2006-08-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.145
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (31)
      • engineered mutation (117)
    Domains in SCOPe 2.05: d2ce2x_
  • Heterogens: MG, GDP, XY2

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ce2X (X:)
    mteyklvvvgaggvgksaltiqliqnhfvdecdptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh