PDB entry 2cd0

View 2cd0 on RCSB PDB site
Description: structure of human lambda-6 light chain dimer wil
Class: immune system
Keywords: immunoglobulin, bence-jones protein, lambda-6, immune system
Deposited on 1999-03-08, released 2000-03-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.289
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (bence-jones protein wil, a variable domain from lambda-6 type immunoglobulin light chain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • GB Z37375 (0-110)
    • conflict (2)
    • conflict (30)
    • conflict (34)
    • conflict (43)
    • conflict (49)
    • conflict (52-53)
    • conflict (66)
    • conflict (66)
    • conflict (95-96)
  Domains in SCOPe 2.04: d2cd0a_
• Chain 'B':
  Compound: protein (bence-jones protein wil, a variable domain from lambda-6 type immunoglobulin light chain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • GB Z37375 (0-110)
    • conflict (2)
    • conflict (30)
    • conflict (34)
    • conflict (43)
    • conflict (49)
    • conflict (52-53)
    • conflict (66)
    • conflict (66)
    • conflict (95-96)
  Domains in SCOPe 2.04: d2cd0b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cd0A (A:)
  nflltqphsvsespgktvtisctrssgsiannyvhwyqqrpgsspttvifeddhrpsgvp
  drfsgsvdtssnsasltisglktedeadyycqsydhnnqvfgggtkltvlg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cd0B (B:)
  nflltqphsvsespgktvtisctrssgsiannyvhwyqqrpgsspttvifeddhrpsgvp
  drfsgsvdtssnsasltisglktedeadyycqsydhnnqvfgggtkltvlg