PDB entry 2cd0

View 2cd0 on RCSB PDB site
Description: structure of human lambda-6 light chain dimer wil
Deposited on 1999-03-08, released 2000-03-08
The last revision prior to the SCOP 1.65 freeze date was dated 2000-03-08, with a file datestamp of 2000-03-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.289
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d2cd0a_
  • Chain 'B':
    Domains in SCOP 1.65: d2cd0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cd0A (A:)
    nflltqphsvsespgktvtisctrssgsiannyvhwyqqrpgsspttvifeddhrpsgvp
    drfsgsvdtssnsasltisglktedeadyycqsydhnnqvfgggtkltvlg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cd0B (B:)
    nflltqphsvsespgktvtisctrssgsiannyvhwyqqrpgsspttvifeddhrpsgvp
    drfsgsvdtssnsasltisglktedeadyycqsydhnnqvfgggtkltvlg