PDB entry 2ccr

View 2ccr on RCSB PDB site
Description: structure of beta-1,4-galactanase
Class: hydrolase
Keywords: beta-1,4-galactanase, glycoside hydrolase family 53, gh-a, galactan, hydrolase
Deposited on 2006-01-18, released 2006-03-21
The last revision prior to the SCOP 1.75 freeze date was dated 2006-03-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yvfo
    Species: BACILLUS LICHENIFORMIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ccra1
  • Chain 'B':
    Compound: yvfo
    Species: BACILLUS LICHENIFORMIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ccrb1
  • Heterogens: B4G, B2G, CA, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ccrA (A:)
    ahrdsgtaksglyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkea
    gvnyvrvriwndpydangngygggnndlekaiqigkratangmklladfhysdfwadpak
    qkapkawanlnfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakms
    qlfnagsqavretdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgt
    lknltsvltsvadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanav
    rdviqavsdvgeagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpeda
    gkwfggsavdnqalfdfkgrplpslhvfqyvdtgtpfkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ccrA (A:)
    glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
    ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
    nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
    retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
    vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
    geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
    nqalfdfkgrplpslhvfqyvdtgtpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ccrB (B:)
    ahrdsgtaksglyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkea
    gvnyvrvriwndpydangngygggnndlekaiqigkratangmklladfhysdfwadpak
    qkapkawanlnfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakms
    qlfnagsqavretdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgt
    lknltsvltsvadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanav
    rdviqavsdvgeagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpeda
    gkwfggsavdnqalfdfkgrplpslhvfqyvdtgtpfkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ccrB (B:)
    glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
    ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
    nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
    retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
    vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
    geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
    nqalfdfkgrplpslhvfqyvdtgtpfk