PDB entry 2ccm

View 2ccm on RCSB PDB site
Description: x-ray structure of calexcitin from loligo pealeii at 1.8a
Class: signaling protein
Keywords: ef hand, calcium, signaling protein
Deposited on 2006-01-16, released 2006-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1906
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calexcitin
    Species: LOLIGO PEALEII [TaxId:6621]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ccma_
  • Chain 'B':
    Compound: calexcitin
    Species: LOLIGO PEALEII [TaxId:6621]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ccmb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ccmA (A:)
    maahqlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhneara
    tlkliwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndt
    sgdniidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrga
    kgnhlfgtlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ccmA (A:)
    aahqlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearat
    lkliwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndts
    gdniidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgak
    gnhlfgtlkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ccmB (B:)
    maahqlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhneara
    tlkliwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndt
    sgdniidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrga
    kgnhlfgtlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ccmB (B:)
    aahqlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearat
    lkliwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndts
    gdniidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgak
    gnhlfgtlkl