PDB entry 2cbr

View 2cbr on RCSB PDB site
Description: cellular retinoic acid binding protein I in complex with a retinobenzoic acid (am80)
Class: transport protein
Keywords: retinoic-acid transport, transport protein
Deposited on 1999-02-22, released 1999-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (crabp-I)
  Species: Bos taurus [TaxId:9913]
  Gene: MOUSE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62964 (0-135)
  Domains in SCOPe 2.08: d2cbra_
• Heterogens: A80, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cbrA (A:)
  pnfagtwkmrssenfdellkalgvnamlrkvavaaaskphveirqdgdqfyiktsttvrt
  teinfkvgegfeeetvdgrkcrslptwenenkihctqtllegdgpktywtrelandelil
  tfgaddvvctriyvre