PDB entry 2cax

View 2cax on RCSB PDB site
Description: structural basis for cooperative binding of ribbon-helix-helix repressor omega to mutated direct DNA heptad repeats
Class: transcriptional repressor/DNA
Keywords: transcriptional repressor, inc18 family of plasmids, ribbon-helix-helix, rhh, metj/arc superfamily, cooperative DNA binding, direct repeats, inverted repeats, DNA heptad 5'-a/t atcac a/t -3', inc18 family, plasmid maintenance, DNA-binding, regulatory protein
Deposited on 2005-12-23, released 2006-03-15
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.21034
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: orf omega
  Species: Streptococcus pyogenes
  Database cross-references and differences (RAF-indexed):
  • PDB 2CAX (2-19)
  • Uniprot Q57468 (1-52)
  Domains in SCOP 1.73: d2caxa1
• Chain 'B':
  Compound: orf omega
  Species: Streptococcus pyogenes
  Database cross-references and differences (RAF-indexed):
  • PDB 2CAX (Start-19)
  • Uniprot Q57468 (Start-52)
  Domains in SCOP 1.73: d2caxb1
• Chain 'C':
  Compound: orf omega
  Species: Streptococcus pyogenes
  Database cross-references and differences (RAF-indexed):
  • PDB 2CAX (2-19)
  • Uniprot Q57468 (1-52)
  Domains in SCOP 1.73: d2caxc1
• Chain 'D':
  Compound: orf omega
  Species: Streptococcus pyogenes
  Database cross-references and differences (RAF-indexed):
  • PDB 2CAX (Start-19)
  • Uniprot Q57468 (Start-52)
  Domains in SCOP 1.73: d2caxd1
• Chain 'G':
  Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*ap *tp*cp*ap*cp*ap*ap*g)-3'
  
• Chain 'H':
  Compound: 5'-d(*tp*tp*gp*tp*gp*ap*tp*tp*tp*gp *tp*gp*ap*tp*tp*cp*g)-3'
  Species: synthetic, synthetic
  
• Chain 'U':
  Compound: 5'-d(*gp*ap*ap*tp*cp*ap*cp*ap*ap*gp *tp*cp*ap*cp*ap*ap*gp*c)-3'
  
• Chain 'Y':
  Compound: 5'-d(*cp*tp*tp*gp*tp*gp*ap*cp*tp*tp *gp*tp*gp*ap*tp*tp*cp*g)-3'
  Species: synthetic, synthetic
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2caxA (A:)
  makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2caxB (B:)
  makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2caxB (B:)
  kdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2caxC (C:)
  makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >2caxD (D:)
  makkdimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2caxD (D:)
  mgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'Y':
  No sequence available.