PDB entry 2cav

View 2cav on RCSB PDB site
Description: canavalin from jack bean
Class: plant protein
Keywords: vicilin, 7s seed protein, domain duplication, swiss roll
Deposited on 1998-11-20, released 1998-11-25
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (canavalin)
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2cava1, d2cava2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cavA (A:)
    mafsarfplwlllgvvllasvsasfahsghsggeaedeseesraqnnpylfrsnkfltlf
    knqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsdsdllvlvlegqailv
    lvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfaitfrrpgtvedfflsst
    krlpsylsafsknfleasydspydeieqtllqeeqegvivkmpkdqiqeiskhaqsssrk
    tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
    ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
    dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
    gqprhidaggkarrahlpnlfrtfy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cavA (A:)
    nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
    sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
    frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmpkd
    dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
    lvanegraevelvglqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaenner
    nflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgq