PDB entry 2cav

View 2cav on RCSB PDB site
Description:
Deposited on 1998-11-20, released 1998-11-25
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-31, with a file datestamp of 2000-03-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2cava1, d2cava2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cavA (A:)
    nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
    sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
    frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmpkd
    qiqeiskhaqsssrktlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnc
    lqmnegalfvphynsratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdi
    ivipssfpvalkaasdlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgee
    veellenqkesyfvdgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cavA (A:)
    nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
    sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
    frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmpkd
    dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
    lvanegraevelvglqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaenner
    nflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgq