PDB entry 2cab

View 2cab on RCSB PDB site
Description: structure, refinement and function of carbonic anhydrase isozymes. refinement of human carbonic anhydrase I
Class: hydro-lyase
Keywords: hydro-lyase
Deposited on 1983-10-05, released 1984-02-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase form b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00915 (Start-259)
      • conflict (73-74)
    Domains in SCOPe 2.03: d2caba_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cabA (A:)
    aspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeii
    nvghsfhvnfednqdrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhv
    ahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfd
    pstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavp
    mqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cabA (A:)
    wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
    sfhvnfednqdrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
    sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
    lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
    nrptqplkgrtvrasf