PDB entry 2ca6

View 2ca6 on RCSB PDB site
Description: miras structure determination from hemihedrally twinned crystals
Class: signaling regulator
Keywords: gap, gtpase activation, gtpase-activating protein, hemihedral twinning, leucine-rich repeat protein, lrr, merohedral twinning, merohedry, rangap, rna1p, signaling protein, signaling activator, nuclear transport, signaling regulator
Deposited on 2005-12-17, released 2006-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.1651
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ran gtpase-activating protein 1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41391
      • conflict see remark 9 (1)
    Domains in SCOPe 2.07: d2ca6a_
  • Chain 'B':
    Compound: ran gtpase-activating protein 1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41391
      • conflict see remark 9 (1)
    Domains in SCOPe 2.07: d2ca6b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ca6A (A:)
    marfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskk
    dleiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflsk
    htplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewa
    ktfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaial
    kswpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvide
    kmpdllflelngnrfseeddvvdeirevfstrgrgeldelddmeeltdeeeedeeeeaes
    qspepetseeekedkeladelskahi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ca6A (A:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ca6B (B:)
    marfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskk
    dleiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflsk
    htplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewa
    ktfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaial
    kswpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvide
    kmpdllflelngnrfseeddvvdeirevfstrgrgeldelddmeeltdeeeedeeeeaes
    qspepetseeekedkeladelskahi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ca6B (B:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee