PDB entry 2c9p

View 2c9p on RCSB PDB site
Description: cu(I)cu(II)-copc at ph 4.5
Class: electron transport
Keywords: copper transport, copper proteins, copper dissociation constants, metal-binding, electron transport
Deposited on 2005-12-14, released 2006-05-03
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: copper resistance protein c
  Species: Pseudomonas syringae pv. tomato
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12376 (0-101)
  Domains in SCOP 1.75: d2c9pa1
• Chain 'B':
  Compound: copper resistance protein c
  Species: Pseudomonas syringae pv. tomato
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12376 (0-101)
  Domains in SCOP 1.75: d2c9pb1
• Chain 'C':
  Compound: copper resistance protein c
  Species: Pseudomonas syringae pv. tomato
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12376 (0-101)
  Domains in SCOP 1.75: d2c9pc1
• Heterogens: CU, NO3, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2c9pA (A:)
  hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
  gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2c9pB (B:)
  hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
  gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2c9pC (C:)
  hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
  gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk