PDB entry 2c9p
View 2c9p on RCSB PDB site
Description: cu(I)cu(II)-copc at ph 4.5
Class: electron transport
Keywords: copper transport, copper proteins, copper dissociation constants, metal-binding, electron transport
Deposited on
2005-12-14, released
2006-05-03
The last revision prior to the SCOP 1.73 freeze date was dated
2006-05-03, with a file datestamp of
2007-06-28.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.19364
AEROSPACI score: 0.38
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: copper resistance protein c
Species: Pseudomonas syringae pv. tomato
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2c9pa1 - Chain 'B':
Compound: copper resistance protein c
Species: Pseudomonas syringae pv. tomato
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2c9pb1 - Chain 'C':
Compound: copper resistance protein c
Species: Pseudomonas syringae pv. tomato
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2c9pc1 - Heterogens: CU, NO3, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2c9pA (A:)
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2c9pB (B:)
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2c9pC (C:)
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk