PDB entry 2c7f

View 2c7f on RCSB PDB site
Description: the structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,5-alpha-l-arabinotriose.
Class: hydrolase
Keywords: arabinofuranosidase, glycosidase, xylan, arabinan, hydrolase
Deposited on 2005-11-23, released 2005-12-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.243
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-l-arabinofuranosidase
    Species: CLOSTRIDIUM THERMOCELLUM [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C7F
      • engineered mutation (182)
    • Uniprot Q4CJG5
    Domains in SCOPe 2.02: d2c7fa1, d2c7fa2
  • Chain 'B':
    Compound: alpha-l-arabinofuranosidase
    Species: CLOSTRIDIUM THERMOCELLUM [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C7F
      • engineered mutation (182)
    • Uniprot Q4CJG5
    Domains in SCOPe 2.02: d2c7fb1, d2c7fb2
  • Chain 'C':
    Compound: alpha-l-arabinofuranosidase
    Species: CLOSTRIDIUM THERMOCELLUM [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C7F
      • engineered mutation (182)
    • Uniprot Q4CJG5
    Domains in SCOPe 2.02: d2c7fc1, d2c7fc2
  • Chain 'D':
    Compound: alpha-l-arabinofuranosidase
    Species: CLOSTRIDIUM THERMOCELLUM [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C7F
      • engineered mutation (182)
    • Uniprot Q4CJG5
    Domains in SCOPe 2.02: d2c7fd1, d2c7fd2
  • Chain 'E':
    Compound: alpha-l-arabinofuranosidase
    Species: CLOSTRIDIUM THERMOCELLUM [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C7F
      • engineered mutation (182)
    • Uniprot Q4CJG5
    Domains in SCOPe 2.02: d2c7fe1, d2c7fe2
  • Chain 'F':
    Compound: alpha-l-arabinofuranosidase
    Species: CLOSTRIDIUM THERMOCELLUM [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C7F
      • engineered mutation (182)
    • Uniprot Q4CJG5
    Domains in SCOPe 2.02: d2c7ff1, d2c7ff2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c7fA (A:)
    mgsshhhhhhmkkarmtvdkdykiaeidkriygsfvehlgravydglyqpgnsksdedgf
    rkdvielvkelnvpiirypggnfvsnyfwedgvgpvedrprrldlawksiepnqvginef
    akwckkvnaeimmavnlgtrgisdacnlleycnhpggskysdmrikhgvkephnikvwcl
    gnamdgpwqvghktmdeygriaeetaramkmidpsielvacgssskdmptfpqweatvld
    yaydyvdyislhqyygnkendtadflaksddlddfirsviatcdyikakkrskkdiylsf
    dewnvwyhsnnedanimqnepwriappllediytfedallvglmlitlmkhadrikiacl
    aqlinviapivternggaawrqtifypfmhaskygrgivlqpvinsplhdtskhedvtdi
    esvaiyneekeevtifavnrnihedivlvsdvrgmkdyrllehivlehqdlkirnsvnge
    evypknsdkssfddgiltsmlrraswnvirigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7fA (A:)
    kkarmtvdkdykiaeidkriygsfvehlgravydglyqpgnsksdedgfrkdvielvkel
    nvpiirypggnfvsnyfwedgvgpvedrprrldlawksiepnqvginefakwckkvnaei
    mmavnlgtrgisdacnlleycnhpggskysdmrikhgvkephnikvwclgnamdgpwqvg
    hktmdeygriaeetaramkmidpsielvacgssskdmptfpqweatvldyaydyvdyisl
    hqyygnkendtadflaksddlddfirsviatcdyikakkrskkdiylsfdewnvwyhsnn
    edanimqnepwriappllediytfedallvglmlitlmkhadrikiaclaqlinviapiv
    ternggaawrqtifypfmhaskygrgivlqpvinsplhdtskhedvtdiesvaiyneeke
    evtifavnrnihedivlvsdvrgmrllehivlehqdlkirnsvngeevypknsdkfddgi
    ltsmlrraswnvirig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c7fB (B:)
    mgsshhhhhhmkkarmtvdkdykiaeidkriygsfvehlgravydglyqpgnsksdedgf
    rkdvielvkelnvpiirypggnfvsnyfwedgvgpvedrprrldlawksiepnqvginef
    akwckkvnaeimmavnlgtrgisdacnlleycnhpggskysdmrikhgvkephnikvwcl
    gnamdgpwqvghktmdeygriaeetaramkmidpsielvacgssskdmptfpqweatvld
    yaydyvdyislhqyygnkendtadflaksddlddfirsviatcdyikakkrskkdiylsf
    dewnvwyhsnnedanimqnepwriappllediytfedallvglmlitlmkhadrikiacl
    aqlinviapivternggaawrqtifypfmhaskygrgivlqpvinsplhdtskhedvtdi
    esvaiyneekeevtifavnrnihedivlvsdvrgmkdyrllehivlehqdlkirnsvnge
    evypknsdkssfddgiltsmlrraswnvirigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7fB (B:)
    karmtvdkdykiaeidkriygsfvehlgravydglyqpgnsksdedgfrkdvielvkeln
    vpiirypggnfvsnyfwedgvgpvedrprrldlawksiepnqvginefakwckkvnaeim
    mavnlgtrgisdacnlleycnhpggskysdmrikhgvkephnikvwclgnamdgpwqvgh
    ktmdeygriaeetaramkmidpsielvacgssskdmptfpqweatvldyaydyvdyislh
    qyygnkendtadflaksddlddfirsviatcdyikakkrskkdiylsfdewnvwyhsnne
    danimqnepwriappllediytfedallvglmlitlmkhadrikiaclaqlinviapivt
    ernggaawrqtifypfmhaskygrgivlqpvinsplhdtskhedvtdiesvaiyneekee
    vtifavnrnihedivlvsdvrgmrllehivlehqdlkirnsvngeevypknsdkssfddg
    iltsmlrraswnvirig
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c7fC (C:)
    mgsshhhhhhmkkarmtvdkdykiaeidkriygsfvehlgravydglyqpgnsksdedgf
    rkdvielvkelnvpiirypggnfvsnyfwedgvgpvedrprrldlawksiepnqvginef
    akwckkvnaeimmavnlgtrgisdacnlleycnhpggskysdmrikhgvkephnikvwcl
    gnamdgpwqvghktmdeygriaeetaramkmidpsielvacgssskdmptfpqweatvld
    yaydyvdyislhqyygnkendtadflaksddlddfirsviatcdyikakkrskkdiylsf
    dewnvwyhsnnedanimqnepwriappllediytfedallvglmlitlmkhadrikiacl
    aqlinviapivternggaawrqtifypfmhaskygrgivlqpvinsplhdtskhedvtdi
    esvaiyneekeevtifavnrnihedivlvsdvrgmkdyrllehivlehqdlkirnsvnge
    evypknsdkssfddgiltsmlrraswnvirigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7fC (C:)
    armtvdkdykiaeidkriygsfvehlgravydglyqpgnsksdedgfrkdvielvkelnv
    piirypggnfvsnyfwedgvgpvedrprrldlawksiepnqvginefakwckkvnaeimm
    avnlgtrgisdacnlleycnhpggskysdmrikhgvkephnikvwclgnamdgpwqvghk
    tmdeygriaeetaramkmidpsielvacgssskdmptfpqweatvldyaydyvdyislhq
    yygnkendtadflaksddlddfirsviatcdyikakkrskkdiylsfdewnvwyhsnned
    animqnepwriappllediytfedallvglmlitlmkhadrikiaclaqlinviapivte
    rnggaawrqtifypfmhaskygrgivlqpvinsplhdtskhedvtdiesvaiyneekeev
    tifavnrnihedivlvsdvrgmrllehivlehqdlkirnsvngeevypknsdkssfddgi
    ltsmlrraswnvirig
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c7fD (D:)
    mgsshhhhhhmkkarmtvdkdykiaeidkriygsfvehlgravydglyqpgnsksdedgf
    rkdvielvkelnvpiirypggnfvsnyfwedgvgpvedrprrldlawksiepnqvginef
    akwckkvnaeimmavnlgtrgisdacnlleycnhpggskysdmrikhgvkephnikvwcl
    gnamdgpwqvghktmdeygriaeetaramkmidpsielvacgssskdmptfpqweatvld
    yaydyvdyislhqyygnkendtadflaksddlddfirsviatcdyikakkrskkdiylsf
    dewnvwyhsnnedanimqnepwriappllediytfedallvglmlitlmkhadrikiacl
    aqlinviapivternggaawrqtifypfmhaskygrgivlqpvinsplhdtskhedvtdi
    esvaiyneekeevtifavnrnihedivlvsdvrgmkdyrllehivlehqdlkirnsvnge
    evypknsdkssfddgiltsmlrraswnvirigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7fD (D:)
    armtvdkdykiaeidkriygsfvehlgravydglyqpgnsksdedgfrkdvielvkelnv
    piirypggnfvsnyfwedgvgpvedrprrldlawksiepnqvginefakwckkvnaeimm
    avnlgtrgisdacnlleycnhpggskysdmrikhgvkephnikvwclgnamdgpwqvghk
    tmdeygriaeetaramkmidpsielvacgssskdmptfpqweatvldyaydyvdyislhq
    yygnkendtadflaksddlddfirsviatcdyikakkrskkdiylsfdewnvwyhsnned
    animqnepwriappllediytfedallvglmlitlmkhadrikiaclaqlinviapivte
    rnggaawrqtifypfmhaskygrgivlqpvinsplhdtskhedvtdiesvaiyneekeev
    tifavnrnihedivlvsdvrgmkdyrllehivlehqdlkirnsvngeevypknsdkssfd
    dgiltsmlrraswnvirig
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2c7fE (E:)
    mgsshhhhhhmkkarmtvdkdykiaeidkriygsfvehlgravydglyqpgnsksdedgf
    rkdvielvkelnvpiirypggnfvsnyfwedgvgpvedrprrldlawksiepnqvginef
    akwckkvnaeimmavnlgtrgisdacnlleycnhpggskysdmrikhgvkephnikvwcl
    gnamdgpwqvghktmdeygriaeetaramkmidpsielvacgssskdmptfpqweatvld
    yaydyvdyislhqyygnkendtadflaksddlddfirsviatcdyikakkrskkdiylsf
    dewnvwyhsnnedanimqnepwriappllediytfedallvglmlitlmkhadrikiacl
    aqlinviapivternggaawrqtifypfmhaskygrgivlqpvinsplhdtskhedvtdi
    esvaiyneekeevtifavnrnihedivlvsdvrgmkdyrllehivlehqdlkirnsvnge
    evypknsdkssfddgiltsmlrraswnvirigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7fE (E:)
    karmtvdkdykiaeidkriygsfvehlgravydglyqpgnsksdedgfrkdvielvkeln
    vpiirypggnfvsnyfwedgvgpvedrprrldlawksiepnqvginefakwckkvnaeim
    mavnlgtrgisdacnlleycnhpggskysdmrikhgvkephnikvwclgnamdgpwqvgh
    ktmdeygriaeetaramkmidpsielvacgssskdmptfpqweatvldyaydyvdyislh
    qyygnkendtadflaksddlddfirsviatcdyikakkrskkdiylsfdewnvwyhsnne
    danimqnepwriappllediytfedallvglmlitlmkhadrikiaclaqlinviapivt
    ernggaawrqtifypfmhaskygrgivlqpvinsplhdtskhedvtdiesvaiyneekee
    vtifavnrnihedivlvsdvrgrllehivlehqdlkirnsvngeevypknsdkssiltsm
    lrraswnvirig
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2c7fF (F:)
    mgsshhhhhhmkkarmtvdkdykiaeidkriygsfvehlgravydglyqpgnsksdedgf
    rkdvielvkelnvpiirypggnfvsnyfwedgvgpvedrprrldlawksiepnqvginef
    akwckkvnaeimmavnlgtrgisdacnlleycnhpggskysdmrikhgvkephnikvwcl
    gnamdgpwqvghktmdeygriaeetaramkmidpsielvacgssskdmptfpqweatvld
    yaydyvdyislhqyygnkendtadflaksddlddfirsviatcdyikakkrskkdiylsf
    dewnvwyhsnnedanimqnepwriappllediytfedallvglmlitlmkhadrikiacl
    aqlinviapivternggaawrqtifypfmhaskygrgivlqpvinsplhdtskhedvtdi
    esvaiyneekeevtifavnrnihedivlvsdvrgmkdyrllehivlehqdlkirnsvnge
    evypknsdkssfddgiltsmlrraswnvirigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c7fF (F:)
    karmtvdkdykiaeidkriygsfvehlgravydglyqpgnsksdedgfrkdvielvkeln
    vpiirypggnfvsnyfwedgvgpvedrprrldlawksiepnqvginefakwckkvnaeim
    mavnlgtrgisdacnlleycnhpggskysdmrikhgvkephnikvwclgnamdgpwqvgh
    ktmdeygriaeetaramkmidpsielvacgssskdmptfpqweatvldyaydyvdyislh
    qyygnkendtadflaksddlddfirsviatcdyikakkrskkdiylsfdewnvwyhsnne
    danimqnepwriappllediytfedallvglmlitlmkhadrikiaclaqlinviapivt
    ernggaawrqtifypfmhaskygrgivlqpvinsplhdtskhedvtdiesvaiyneekee
    vtifavnrnihedivlvsdvrgmkrllehivlehqdlkirnsvngeevypknsdksfddg
    iltsmlrraswnviri