PDB entry 2c78

View 2c78 on RCSB PDB site
Description: ef-tu complexed with a GTP analog and the antibiotic pulvomycin
Class: hydrolase
Keywords: hydrolase, gtpase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding, phosphorylation, protein biosynthesis, elongation factor
Deposited on 2005-11-18, released 2006-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.1967
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu-a
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SHN6 (Start-404)
      • conflict (263)
    Domains in SCOPe 2.06: d2c78a1, d2c78a2, d2c78a3
  • Heterogens: GNP, MG, PUL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c78A (A:)
    akgefvrtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    qmhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreever
    gqvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c78A (A:)
    kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
    eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
    pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
    rrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvk
    vgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreevergqvlakpg
    sitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnv
    tftvelikpvaleeglrfaireggrtvgagvvtkile