PDB entry 2c77

View 2c77 on RCSB PDB site
Description: ef-tu complexed with a GTP analog and the antibiotic ge2270 a
Class: hydrolase/antibiotic
Keywords: hydrolase-antibiotic complex, thiopeptide, antibiotic, antibacterial, thiazole, oxazole, hydrolase, gtpase, translation elongation factor, protein synthesis, nucleotide-binding, phosphorylation
Deposited on 2005-11-18, released 2006-03-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor Tu-B
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60339 (Start-404)
      • conflict (32)
    Domains in SCOPe 2.05: d2c77a1, d2c77a2, d2c77a3
  • Chain 'B':
    Compound: thiocillin ge2270
    Species: PLANOBISPORA ROSEA [TaxId:35762]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GNP, MG, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c77A (A:)
    akgefirtkphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    qmhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreever
    gqvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c77A (A:)
    kgefirtkphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargi
    tintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehil
    larqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleq
    mhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgr
    iergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreeverg
    qvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvem
    vmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'B':
    No sequence available.