PDB entry 2c74

View 2c74 on RCSB PDB site
Description: 14-3-3 protein eta (human) complexed to peptide
Class: signaling protein/peptide
Keywords: signaling protein-peptide complex, 14-3-3, phosphoserine, phosphorylation
Deposited on 2005-11-17, released 2005-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein eta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C74
    • Uniprot Q04917 (2-End)
    Domains in SCOPe 2.07: d2c74a_
  • Chain 'B':
    Compound: 14-3-3 protein eta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C74
    • Uniprot Q04917 (2-End)
    Domains in SCOPe 2.07: d2c74b_
  • Chain 'P':
    Compound: consensus peptide mode 1 for 14-3-3 proteins
    Database cross-references and differences (RAF-indexed):
    • PDB 2C74 (Start-6)
  • Chain 'Q':
    Compound: consensus peptide mode 1 for 14-3-3 proteins
    Database cross-references and differences (RAF-indexed):
    • PDB 2C74 (Start-6)
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c74A (A:)
    smgdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvgarrss
    wrvissieqktmadgnekklekvkayrekiekeletvcndvlslldkflikncndfqyes
    kvfylkmkgdyyrylaevasgekknsvveaseaaykeafeiskeqmqpthpirlglalnf
    svfyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwtsdqqd
    eeagegn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c74A (A:)
    gdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvgarrsswr
    vissieqktmadgnekklekvkayrekiekeletvcndvlslldkflikncndfqyeskv
    fylkmkgdyyrylaevasgekknsvveaseaaykeafeiskeqmqpthpirlglalnfsv
    fyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwtsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c74B (B:)
    smgdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvgarrss
    wrvissieqktmadgnekklekvkayrekiekeletvcndvlslldkflikncndfqyes
    kvfylkmkgdyyrylaevasgekknsvveaseaaykeafeiskeqmqpthpirlglalnf
    svfyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwtsdqqd
    eeagegn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c74B (B:)
    gdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvgarrsswr
    vissieqktmadgnekklekvkayrekiekeletvcndvlslldkflikncndfqyeskv
    fylkmkgdyyrylaevasgekknsvveaseaaykeafeiskeqmqpthpirlglalnfsv
    fyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwts
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.