PDB entry 2c6u

View 2c6u on RCSB PDB site
Description: crystal structure of human clec-2 (clec1b)
Class: lectin
Keywords: lectin, clec-2, rhodocytin, aggretin, c-type lectin-like, platelets, thrombosis, clec1b
Deposited on 2005-11-11, released 2006-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.161
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clec1b protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2c6ua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c6uA (A:)
    spcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikarthlirwv
    glsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhylmcerk
    ag