PDB entry 2c6n

View 2c6n on RCSB PDB site
Description: structure of human somatic angiontensin-I converting enzyme n domain with lisinopril
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, angiotensin-I converting enzyme, n domain, zinc metallopeptidase, metalloprotease, angiotensin, lisinopril, carboxypeptidase, glycoprotein, metal-binding, phosphorylation, protease, transmembrane, hydrolase-hydrolase inhibitor complex
Deposited on 2005-11-10, released 2006-03-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-21.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.294
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Angiotensin-converting enzyme, somatic isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c6na_
  • Chain 'B':
    Compound: Angiotensin-converting enzyme, somatic isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c6nb_
  • Heterogens: NAG, ZN, CL, LPR, GOL, NDG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c6nA (A:)
    ldpglqpgnfsadeagaqlfaqsynssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqnftdpqlrriigavrtlgsanlplakrqqynallsnmsr
    iystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwnathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlqagssrpwqevlkdmvgldaldaqpllkyfqpvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypegid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c6nB (B:)
    ldpglqpgnfsadeagaqlfaqsynssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqnftdpqlrriigavrtlgsanlplakrqqynallsnmsr
    iystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwnathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlqagssrpwqevlkdmvgldaldaqpllkyfqpvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypegid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c6nB (B:)
    dpglqpgnfsadeagaqlfaqsynssaeqvlfqsvaaswahdtnitaenarrqeeaalls
    qefaeawgqkakelyepiwqnftdpqlrriigavrtlgsanlplakrqqynallsnmsri
    ystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftal
    sneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdry
    inlrgpipahllgdmwaqsweniydmvvpfpdkpldvtstmlqqgwnathmfrvaeefft
    slelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhe
    mghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdi
    nyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrnet
    hfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrk
    vlqagssrpwqevlkdmvgldaldaqpllkyfqpvtqwlqeqnqqngevlgwpeyqwhpp
    lpdnypegi