PDB entry 2c61

View 2c61 on RCSB PDB site
Description: crystal structure of the non-catalytic b subunit of a-type ATPase from m. mazei go1
Class: hydrolase
Keywords: hydrolase, a-type ATP synthase, h+ ATPase, a1ao, non-catalytic, ATP synthesis, hydrogen ion transport, ion transport, transport
Deposited on 2005-11-06, released 2006-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.187
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: a-type ATP synthase non-catalytic subunit b
    Species: METHANOSARCINA MAZEI GO1 [TaxId:192952]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c61a1, d2c61a2
  • Chain 'B':
    Compound: a-type ATP synthase non-catalytic subunit b
    Species: METHANOSARCINA MAZEI GO1 [TaxId:192952]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C61
    • Uniprot Q60187 (Start-468)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c61A (A:)
    mkhhhhhhpmvkeyktitqiagplifvektepvgyneivnikmgdgtvrrgqvldssadi
    vvvqvfegtggldkdcgviftgetlklpasvdllgrilsgsgeprdggprivpdqlldin
    gaamnpyarlppkdfiqtgistidgtntlvrgqklpifsasglphneialqiarqasvpg
    sesafavvfaamgitneeaqyfmsdfektgaleravvflnladdpaverivtprmaltaa
    eylayehgmhvlviltditnyaealrqmgaarnevpgrrgypgymytdlatlyeragivk
    gakgsvtqipilsmpgddithpipdlsgyitegqivvarelhrkgiyppinvlpslsrlm
    nsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedkf
    vrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahrkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c61A (A:)
    gplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfftgetlklpasvdll
    grilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistidgtntlvrgqk
    lpifsasglphneialqiarqasvpgsesafavvfaamgitneeaqyfmsdfektgaler
    avvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaealrqmgaarne
    vpgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpipdlsgyitegq
    ivvarelhrkgiyppinvlpslsrlmnsgigagktredhkavsdqmyagyaegrdlrglv
    aivgkealserdtkflefadlfedkfvrqgrnenrtiedtleigwqilthlpenqlgrid
    nkyiqkyhpahr
    

  • Chain 'B':
    No sequence available.