PDB entry 2c60

View 2c60 on RCSB PDB site
Description: crystal structure of human mitogen-activated protein kinase kinase kinase 3 isoform 2 phox domain at 1.25 a resolution
Class: transferase
Keywords: map3k3, map/erk kinase kinase 3, mapkkk3, mekk3, serine threonine phosphorylation, ATP-binding, kinase, magnesium, metal-binding, nucleotide-binding, phosphorylation, serine/threonine-protein kinase, transferase
Deposited on 2005-11-04, released 2005-11-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.166
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human mitogen-activated protein kinase kinase kinase 3 isoform 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c60a1
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c60A (A:)
    mhhhhhhssgvdlgtenlyfqsmghsnrqsdvrikfehngerriiafsrpvkyedvehkv
    ttvfgqpldlhymnnelsillknqddldkaidildrsssmkslrilllsqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c60A (A:)
    gtenlsdvrikfehngerriiafsrpvkyedvehkvttvfgqpldlhymnnelsillknq
    ddldkaidildrsssmkslrillls