PDB entry 2c56

View 2c56 on RCSB PDB site
Description: A comparative study of uracil DNA glycosylases from human and herpes simplex virus type 1
Class: hydrolase
Keywords: hydrolase, uracil DNA glycosylase, DNA repair, DNA damage, glycosidase
Deposited on 2005-10-26, released 2005-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil DNA glycosylase
    Species: HUMAN HERPESVIRUS 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10186 (Start-243)
      • engineered mutation (87)
      • engineered mutation (209)
    Domains in SCOPe 2.06: d2c56a_
  • Heterogens: SUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c56A (A:)
    mdltnggvspaatsapldwttfrrvfliddawrplmepelanpltahllaeynrrcqtee
    vlppredvfswtryctpdevrvviigqnpyhhpgqahglafsvranvppppslrnvlaav
    kncypearmsghgclekwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarr
    pglvfmlwgthaqnairpdprvhcvlkfsnpsplskvpfgtcqhflvanryletrsispi
    dwsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c56A (A:)
    ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
    pdevrvviigqnpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
    kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
    rpdprvhcvlkfsnpsplskvpfgtcqhflvanryletrsispidwsv