PDB entry 2c53

View 2c53 on RCSB PDB site
Description: a comparative study of uracil DNA glycosylases from human and herpes simplex virus type 1
Class: hydrolase
Keywords: hydrolase, uracil DNA glycosylase, DNA repair, DNA damage, glycosidase
Deposited on 2005-10-25, released 2005-11-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil DNA glycosylase
    Species: HUMAN HERPESVIRUS 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10186 (Start-243)
      • engineered mutation (87)
      • engineered mutation (209)
    Domains in SCOPe 2.01: d2c53a_
  • Heterogens: DUR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c53A (A:)
    mdltnggvspaatsapldwttfrrvfliddawrplmepelanpltahllaeynrrcqtee
    vlppredvfswtryctpdevrvviigqnpyhhpgqahglafsvranvppppslrnvlaav
    kncypearmsghgclekwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarr
    pglvfmlwgthaqnairpdprvhcvlkfsnpsplskvpfgtcqhflvanryletrsispi
    dwsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c53A (A:)
    ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
    pdevrvviigqnpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
    kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
    rpdprvhcvlkfsnpsplskvpfgtcqhflvanryletrsispidwsv