PDB entry 2c4h

View 2c4h on RCSB PDB site
Description: torpedo californica acetylcholinesterase in complex with 500mm acetylthiocholine
Class: hydrolase
Keywords: hydrolase, serine esterase, synapse, membrane, neurotransmitter cleavage, alpha/beta hydrolase, substrate- inhibition, alternative splicing, glycoprotein, gpi-anchor, lipoprotein, neurotransmitter degradation
Deposited on 2005-10-19, released 2006-06-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.169
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Torpedo californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2c4ha_
  • Heterogens: NAG, NDG, PGE, AT3, ACE, CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c4hA (A:)
    ddhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwna
    stypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggf
    ysgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwv
    hdniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvae
    grrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgef
    fptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsv
    phandlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyl
    yffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktg
    npnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnatac
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4hA (A:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnata